BROCHURE

HollySys Turbine Control System

Digital Electro-Hydraulic System (DEH) Emergency Trip System (ETS) Turbine Supervisory Instruments (TSI)

Since entering the field of DEH (Digital Electro-Hydraulic System) in the 199Os, HollSys has accumulated rich industry experience and engineering implementation experience through nearly 30 years of in-depth research on turbine control.tsverallprofesional andrelalelutionshavebeensuccessfullyaplied tmalmediumandlrgescal plants forunits ranging from3MWto1000MW.yDecember 22salesof theDEH systemhad exceeded 6,500 set HollySyshasalsoapplied formore than30patents, and its olutionshave gained wide industryadoption and promtion. WithHllyscontinuousdeening and ivationoftheturbinecontrl technolgyit wilfurtherpromte thevigorous development of DEH, ETS (Emergency Trip System) and TSI (Turbine Supervisory Instruments).

Contents

01 System Overview

01
02
02

Features and Advantages Applicable Model Technical Data

03 Product Family

DEH
ETS
TSI
EH Hydraulic Control System

09

11 Advanced Features

Primary Frequency Regulation SecondaryFrequency Regulation OPC Function
Decoupling Function

ATC Function 18

Valve Management

Simulation Function 20

ConcentratedSolarPower 19 Combined Cycle Power Generation Isolated Grid CoordinationControl in High-Altitude Remote Areas 21 DEH Retrofit

13 Smart Functions 22

Services

23

APS Automatic Start-Stop System Remote Expert Diagnosis Intelligent Isolated Grid Coordination System

Typical References

14 Typical Cases

1,000 MW-Level Thermal Power
Waste-to-Energy
Blast Furnace Gas Power Generation(Reheat Unit)
Petrochemical Self-SuppliedPowerStation

System Overview

AsthethreecearysytemsforturbinecontrolHimainlreponsiblefrcontrlling thestaruppeedinrease operating under load and load regulation of the turbine to ensure stable operation of aturbine unit.ETS is mainly responsibleforautomaticallyandquicklycuingoff thesteamintakeofaturbinewhenafault occurstoprotect thenit. TSlcancontinuuslacuratelandreliablymonitor thmportant parametrsof turbinestartup,perationand shutw throughsensors.Whenthemonitored parameters exceed thelimit,it canaccurateland timelyreports alarmsorshutdw signals.

Features and Advantages

IntelligentVelocityMeasurement

TheDEHspecial speed measurementmodule(3out of 2) adopts the latest all-digital circuit,which can generate primary frequency regulation quantity, and cooperate with the servo module to complete thefast primary frequency control function.

Efficient Configuration

With built-in fast DP (redundant) bus and CAN (redundant) bus, the primary frequency control function adopts independent high-speed CAN bus fast communication loop technology, featuring quick response.

IntelligentServo

TheDEHspecialservomoduleadoptsthelatest all-digital circuit, and cooperates with the DEH special speedmeasurementmodule to complete thefast primary frequency control function through the CAN bus.

Redundancy andReliability

Servo module adopts redundancy configuration. Any servo channel can realize online redundant hot standby, and can automatically switch to the standbymodule when it is judged that the working module is faulty, and the switching time of theservo module is \r_{{s}}<=10{ms}

Servo valve adopts redundancy configuration.Two servo valvesreceivecommandsignalsatthesametime to drive theoil motive toact.Whenoneof theservovalves is determined tobefaulty,aclosurecommand is issued to the lockout valve of that servo valve.Subsequently, theremainingservovalvetakesoveralloperationswhile an isolation electromagnetic valve is actuated to cut off the oil flow. Additionally, a shut-off valve on the oil line is used to isolate the fault point for maintenance, ensuring the continuous operation of the unit.

QuickMasterControl

The minimum IEC operating period of the controller is 10ms, whichcanmeet therapidityrequirementsof ultra-supercritical units.

FastFrequencyRegulation

Withqualifiedprimaryfrequencyregulationcapability, DEH can make the regulation period lower than 30 ms (non-control period).

High-PerformanceHydraulicControl

Thehydrauliccontrolsystemutilizesanindependenthighpressure 14 MPa control oil source, and the control of the oilactuatedmotorisintegrated intotheservocontrolsystem. This hydraulic control system is capable of achieving an oilactuatedmotorresponsetime of less than0.3s.

ApplicableModel

Technical Data

Speed adjustmentrange Turning gear speed at 120% of rated speed Speedmeasurement accuracy ≤±1 r/min
1 Load control range Oto 120%, accuracy 0.5%
■ Speed variation ratio Continuously adjustable within a range of 3 to 6%
■ Control system insensitivity <0.06%
■ Maximumoverspeed atfullload <7% of rated speed and able to maintain idling
■ Steamextractionpressurecontrol accuracy ±0.01 MPa (suitable for C/CC units) Steamextractionpressureunevenness Oto 20%
■ System control cycle <50 ms
■ MinimumIECoperating cycle 10 ms
Anti-interferencemeasure Resistancetointerferencefromvariouselectromagnetic waves and communication devices on site,complying with IEC61131-2 and IEC61000-4 standards

DEH

DEH(Digital Electric Hydraulic Control System) is a real-time comprehensive control system for steam turbine generator units. Its primary tasks include adjusting input power, valve positions, and pressure levels to meet external load demands according to customerspecifications.

T80SeriesUniversalTurbineController

Tserrluriallerhrualeha loopsteaturienratotachaeestemureratritandndstrialrit Thehardwaref theontllerdptsstriagradmnntstenurethestableandrelaleerationofthecotrlet industrial environment for a long time.

System Features

Digitization Fulldigitttihitieituiielitaf various electro-hydraulic
IEase of use Simple andeasy-to-usehuman-machine interfacesoftwaresimpleparametersettings,clearand reliable
■Safety Control system designed according to the principles of "fail-safe protection" and "safety self-lock"
■ Miniaturization Small sizecompactstructureasytointgratetherquipment,ffectivelysavinginstallationpace

Main Functions

■System adjustment

peedoltagidtadwnure mode,primary frequency regulation

Limit control Overspeed limit(103% no),valve position limit,high load limit, low main steam pressure limit

■Protection control Overspeed protection (170%\ n_{0})

■ System testing

Overspeedtest,OPCfast-closingvalvetest,offlinesimulationtest,leakagetest

K series DEH (T800K) is a general-purpose system designed based on HOLLiAS ⑧ MACS-K. It adopts fast master control, dedicated alldigitalintielurttlaandqdwfr I/0 redundant modules to meet the stability requirements of different working conditions.

System Features

■ Reliability Fullreddantlfutonealiinllredantonfiguratonfstwuplyfdweup communication bus

Flexibility

Support for redundancy configuration of RTD,TC, Al, AO, Dl, and DO as well as the servo module

Safety

Control system designed according to the principles of "fail-safe protection" and "safety self-lock"

■Adaptability

Dedicatedaitteligetermdlandsdmeremntprtetimdapblefdrngvarisltroa servovalLdirectlyontedtotheseotrolmdulefrmdulationandemdulationand suort forilatd grid operation capability

■ Maintainability

Modular system design, making troubleshooting and component replacementeasy

■ Coordination Shared withDCS data for coordinated control

Main Functions

System adjustment

Spedcorlagidtioardwentdpurenl mode prmaryfqnyreulatiolmanentmatilathinmatieninf thmanstamalandrt control of the EH oil station

■Limit control

Overspeedlimit (703%\ n_{0}) ,valve position limit, high load limit, low main steam pressure limit,fast load reduction, low vacuum load limit, back pressure limit

Protection control Overspeed protection (110% no)

■ System testing

ummrdtttiu closingvalvetest,oil injectiontest,offline simulationtest

NseriesEHTONageneralurpsystmesignedbasedonLLAclerwelantdiitaistrumentadon ystemificaldlawtweriitinwithtcialifatof t pwerndstrandmtingtheamaticonrquirementsflewurbeenratittalizetheintgrat management of DcS and turbine monitoring and control for nuclear power units.

System Features

■Rapidity Minimumpratipridfmwhicameet therequirentftheturinontrolfmgateerw
Reliability Support folrdanynfiguratofpwentrolletwrandmicationlasfaltdinsi switching
Security Master/laecntrollet stadbredanyeriodcalydndanty tranferinalldtathrouhdecatdreda network to ensure seamless switching
■Flexibility Special peedmeasurementmdleM5ervmoduleM6andful-iital prgrammablemdulwhchcan independently or integrated with HollySys main control systems through Profibus-DP bus

MainFunctions

■ System control and adjustment

Turbinelathi,i stadrgulatamticroizatigridcetiodcnapsit powercontrol,pressure control,remotecontrol,coordinated controlprimaryfrequencyregulatin
Limit control Overspeed limit, valve position limit, load limit,pressure limit,fast load reduction,flow limit
■Online system testing Overspeed test, valve exercise test,valve tightness test, OPC action (optional)

ETS

ETS (Emergency Trip System) for turbines is designed to monitor certain parameters that significantly affect the safe operation of the unit.When these parameters exceed the safety operation limits, the system actuates the trip solenoid valve to control the turbine protection system, closing all steam inlet valves to the turbine,initiating an emergency shutdown.Additionally,it provides shutdown diagnostic information to systems such as SOE(Sequence of Events).

PLC-based ETS (ETS-LM)

ThePLC-basedTLMisdvelopedbasedontheolysMGserieCplafomwhichletorefuntionsuchasd aquisiolatonadtiualettgtmastanlletadataf fatilldi decrease of protection conditions,etc.

SystemFeatures

■Rapidity Support forreddanyofiguratiof themlean pweuplsstt affetewhenanyt fCfailr power supply disappears
Safety Input andoutputof thewsetsofredundantCsystemsadptingrelaforisolationandphysicalloophardiolationtonre system safety and stability
■Rapidity System control cycle <20 ms

Anti-inteference

Antinterferencmeauresdfrsistiariosltrmanetiwavadmicatinquientnsitandclia withIEC61131-2andIEC61000-4standards

Integrated ETS (ETS-K)

The integrated ETS-K adopts HollySys HOLLiAS ⑧ MACS-K system as the platform, and redundant fast main controllers to form the ETS systemwhotiuseeivalamsadswinalfrtystmsytmadotheqpmntofth generatoret onlin ad pfomcmprehensielgijmenthesstemissuitablefrmediumandlargeturbinet.Wh th nmaleratf thftdarirttialshhaditfthit ree make theturbine shut down safely,andprovideshutdowndiagnosisinformationforDCS andSOEsystems

System Features

■Reliability Independent ystem,redundant onfiguratinindpendent rdundantfast controllrand redundant wer l
■Rapidity IEC operation cycle of 10 ms, 20 ms, 40 ms, 50 ms
Anti-interference Antitererencemeasursued forresisting variuslctromagnetic waves andcmunicationequipmet onsite andcomplant with IEC61131-2 and IEC61000-4 standards
■Safety Variostripcmmandalamandparialrelaontroluitsanamtialyactiatnthhdwlenidtquicl the steam inlet valvewhen aturbine generatorfault orotherfault occurs

Triple-RedundantETS (ETS-SGM)

TheTapttuaSafttrudtitlahhvedltat industrialatoanalzemergenhtdwudieridhlandtriericnm safetyrelaliatioasindan thaftgraeprtet atidddat

System Features

Reliability SIL3 security level and two-of-three architecture with diagnosis (2oo3D) used to ensure system security
■Security Support frdegraddperatinwithamoderedundant configuratiof moduleeamlesswitching,and yt availability of 99.999%
Widecoverage Fault diagnosis located to the channel level
1 Highperformance SOE accuracy of 1 ms
■Integration Seamless integration with HOLLiAS ⑧ MACS system,and support forintegration with third-partyDCS through the Modbus interface Scale Upto1maincage and6 expansion cages supported bya single station,and upto18561/0points

TSI

TSI (Turbine Supervisory Instrument) is a crucial means of monitoring and protecting the safe operation of turbines.It continuously, accurately,and reliably monitorskeyparameters during the startup,operation,and shutdown processes of a turbine. When the monitored parameters exceed the limits, it can promptly and accurately issue alarms or shutdown signals to ETS. TSl can also output standard 4 to 20\mathsf{m A} signals for monitoring purposes.

Main Functions

■ Surveillance of expansion difference ■ Surveillance of bearing bush vibration

口 Handheld programmer 口 Speed surveillance 口 Axial displacement surveillance

■ Surveillance ofrelative shaft vibration
■ Thermal expansion surveillance

Electro-Hydraulic System

The hydrauliccontrolsystemexists invariousformsincluding thelw-pressure turbineoilcontrol system,thehih pressure anti-wear oil control system, and the high-pressure fire-resistant oil control system.

Low Pressure Turbine Oil Control System (EH-HLP)

The low pressure turbine oil control system retains the power oil source from the original hydraulic control system, which is the main oil pump supply method. The control valve actuatoris converted to an electro-hydraulic servo actuator. The control valve is managed through the original valve mechanism (cam or lift plate). The valve position command signal generated by DEH is processed through the servo amplifier board and the electrohydraulic convertervalve,forming the control oil pressure to the throttlevalve,thereby actuating the servo motor.The actuator stroke ismeasured by a displacement sensor and fed back to the input of the servo amplifierboard,ensuring it matches the valve position command. This allows the actuator stroke to be fully controlled by DEH.

High Pressure Anti-Wear Oil Control System (EH-ZRS)

The high-pressure anti-wear oil control system includes an integrated independent oil source, providing a qualified high-pressure working oil source for the normal operation of the entire hydraulic control system.The working fluid uses environmentally friendly antiwear hydraulic oil withturbine oil characteristics,offering the same controlprecision and fire-resistant properties.This system features high positioning accuracy, large driving force,stepless speedregulation,and rapid shutdown protection,making it highly costeffective and suitable for small to medium-sized units. Its main components include an independent oil source unit (oil station,accumulator,anti-wear hydraulic oil,etc.),a servo actuator(servo motor, servo valve,OPC solenoid directional valve,etc.),a trip control system, and an oil pipeline system (oil pipelines and various valves).

System Features

1 High precision Independent oil source pressure of 14.0 MPa,and high output stiffness for an actuator
■Reliability Antweraliodfiatf thintilt sets of oil pumps mutually reserved
■ Availability ■Rapidity 100% continuous adjustable work, and closed-loop servo control system Dynamic response time < 0.3s, and fast closing time <0.25
■ Convenience Actuatorthatac inizeadeaytinstal dsasslftheactuatrt qirdfanalmaintenac adrla only the seals of the hydraulic components on the pump station and actuator

High Pressure Fire-Resistant Oil Control System (EH-HHP)

The high-pressure fire-resistant oil control system includes an integrated independent oil source, providing a qualified high-pressure working oil source for the normal operation of the entire hydraulic control system. The working fluid uses phosphate ester fireresistant hydraulic oil, offering high positioning accuracy,large driving force,stepless speed regulation,and rapid shutdown protection,making it suitable for large units.Its main equipment includes an independent oil source unit (oil station,regeneration unit, accumulator fire-resistant oiletc.),aservo actuator(actuator,servovalve,OPC solenoid directional valve,etc.), a trip control system, and an oil pipeline system (oil pipelines and various valves).

System Features

■High precision ■ Reliability Independent oil source pressure of 14.0 MPa,and high output Redundant configuration of the oil supply pump in the oil stiffness for an actuator supply system, and two sets of oil pumps mutually reserved
■Rapidity ■ Oilrequirement Dynamic response time < 0.3s, and fast closing time <0.25 Phosphoric acid grease resistant fuel
Maintenancerequirement Relaftqqf and maintenance of equipment

Advanced Features

OPCfunction

Toprevent shutdown due to speed fluctuations in small grids,the 103% no action value needs to be masked. The DEH system should add an OPC function for high acceleration to suppress load rejection overspeed. This function detects when the acceleration exceeds a predetermined value.When the speed exceeds a certainthreshold,thehigh acceleration OPC signal is triggered, causing the control valve to close rapidly.Once the speed decreases,the OPC signal is canceled, and control is handed back to the regulation system.

Primary Frequency Regulation

DEH should have a fast and reliable primary frequency regulation function. If the grid frequency deviatesfromtheratedvalue,the primaryfrequencyregulationfunctionof the unit willautomatically control the increase or decrease of the unit's active power, limiting the grid frequency fluctuation, maintaining grid frequency stability, and ensuring the safe operation of the unit.

Secondary Frequency Regulation

By changing the setpoint of the frequency regulationunit's speed control system,the outputpower is adjusted tobring the grid frequency back to the rated value, ensuring stable operation of the grid.

Decoupling Function

A cogeneration unit provides both power and heat, and there is a certain coupling relationshipbetween the two. Changing the opening of any control valve will affect both the extraction steamflow and the power generation. The decoupling coefficient is calculated based on the unit's thermal balance data to achieve balanced decoupling control of all parameters.

Valve Management

Tobalance the thermal efficiency and lifespan consumption of the unit, DEH includes a valve management function.Operators can easily choosebetweensingle-valve operationor sequentialvalveoperationasneeded.This includestheswitchingbetweenmainsteam valve control and control valve regulation, linearization correction ofvalveflow characteristics,generationofsequentialvalve functions,generation of single-valvefunctions, coefficient settings,and overall valve position correction, allowing for seamless multi-valve/ single-valve switching.

Simulation Function

When the unit has tripped, DEH can enter simulation mode, simulatingvarious operating conditions and scenarios of the turbine.This simulation mode can replicate most functions such asregulation,protection, and testing.Thisfeatureis useful for conveniently debugging configuration software and training on-sitepersonnel.The simulation function of the turbine is significant forimproving itsperformance,reliability,and safety.

LVDT Rod Drop Ditection

In the existing redundant LVDT (Linear Variable Differential Transformer) within the servo loop, if the LVDT core rod fastening nut loosens or completely falls off, leading to a rod drop failure, the faulty LVDT signal may still be used. This could cause the actual actuator stroke to deviate from the set value,potentially leading to fully open or fully closed positions and endangering the unit's safety. The HollySys intelligent servo module introduces an analog actuator integration segment, greatly enhancing the ability to detect LVDT failures and improving the reliability of the servo system.

ATCFunction

ATC (Automatic Turbine Control) function of the turbine is a feature for automaticprogramcontrol. DEH monitors the turbine's status and calculates rotor stress. Within the allowable stress limits of the unit, it optimizes the startup procedure to achieve the fastest and shortest automatic startup, acceleration,and load change.Throughout the startup, shutdown,or load change processes,it performs closed-loop automatic control to keep the rotor stress within permissible limits. During normal operation,the ATC function also provides supervisory capabilities to ensure the safe and stable operation of the turbine.

Advanced Functions

APS Automatic Start-Stop System

Tholtsltl operationanthflratnafeaamtstadwfthit interventithwrldfatretmeratidrenhtrqirestah thereby achievingreasonable safety and economicbenefits.

Theontroltuidmnlyllatteatytatitilsyt gearsystmumystmranaystmhafalingtmasystm

Thecontrolontheelectricalsidemainlyincludesexcitationsystemand synchronization gridconnectionsystem.

Remote Expert Diagnosis

Remote expergsisisaneficint andcnvenent techicamensthatmtsthenesof industrlsesforremtemonitori throughremotedesktopcontroltchnologybasedonvidecompressiontranmision.Expertscanremotelymonitoranddian theindustrlconrol systmsandoth proessparmeterofanenterprishisawsforthcoletionandaalyisfntri datarelatetystquipmet andlatratioerfancxtractifmatioeletqnt staufm andoperatinnditionsandrpingmprvementmureolycanpachivemteeratiomnitringandptimi preventiannrtlthefcdaraffaltdiaisaedemnt costs andshortenfaulthandling time,therebyensuring thecontinuityandstabilityof theproductionprocess.

Intelligent Isolated Grid Coordination System

The Hllysintligent isolated gridcordinationsystemisacomprehensiveenergycoordinationmanagement sstemdeveledfr pwerentpreratnth samentrllaysadelrial ytvidngfastutatnalrt capabithsystmmnitoariomatonadstatusesonbth thenerationandonutioidrei thcoordintnaddiathfrelatystshsandeltristmain theeeeatioits t cllaboratstts thqtfarisplatearihstantaelatdgridadc isolated grid, for power generation enterprises.

Typical Cases

1,000 MW-Level Thermal Power

China Energy Group Yongzhou 2 × 1,0o0 MW Turbine Unit DEH Project

Advances the Benchmark in the Thermal Power Industry to Seize the High Ground of Ultra-Low Emissions

Project Background

TheChinaEnergyGropYngzhuhaeMurbinenit Prjt isthefirst miionilowat powerit inHnanPrinc. Theprjtladtetladcaaitfadeeiatdrianere demonstration project for"ultra-low emissions and ecological civilization".

System Application

Theturbinregulationsystmistheollyhighpressurefireresistantoilturbiedigiteltrohyraulicontrolyst pvidinraaiilif systems.The PhaseIproject entered commercialoperation with the commissioning of two unitsin 2021.

Waste-to-Energy

EverbrightBoluoN25 MWWaste-to-EnergySystem Project

Smart Technology Achieves Dual Enhancement of Economic and Environmental Benefits

Project Background

EverbrightGrourueba0catsuidaverihtmentalEeBlastal reheatinstemurneratrtfrasteratiopw geeratiprt iuangdngronchnhisrt marks thefistofitat thetyeiin hpaersdfeauiadahlgiuhaaeat parameter settings, reheating units, and intelligent power plant systems.

System Application

Theprjtaptsthdielthrltrlflgrurefistat sttriant uses intelligent technologies such as the APS automatic start-stop system of the whole plant.

Blast Furnace Gas Power Generation (Reheat Unit)

Fangchenggang Shenglong Metallurgy 145 MW Ultra-Supercritical Unit DEH System Project

Intelligent Manufacturing Helps Set Multiple World Records

Project Background

ShenglongMugysf thentpranf thstepinhrdth first 3×N145MWsupercritical gas generatorunit wasbuilt.Thepower generationefficiencyof asingleunit reaches 43.5%, and the annual powergenerationcapacity is1.06billionkWh,whichcanreducecarbondioxideemissionsby854KTA.

System Application

Theprojt adptsthditelrhralntroytflhipressurersistat steturia inteligenthlhasatitrstytf thwlehtafrehealdrerh aseratireueruepweefcfieraterattle intellectual property rights and localized equipment.

Petrochemical Self-Supplied Power Station

Yangzi Petrochemical Green Steam Supply Center 2 x CB50 MW Project

Contributes Cutting-Edge Capabilities to Build World-Leading Clean and Smart Energy

Project Background

The 3x540 t/h coal-fired boiler and 2x CB50 MW steam turbine units of the green steam supply center project of Sinopec Yangzi Petrhiaretsfnirhlratethrftertz consumptionstructure,andhelrealizecarbonpeakingandcarbonneutraltywithgreenandl-carbondevelopmet

System Application

The project launched a 2x CB50MWextraction-backsteamturbine generatorset,which adopts the digitalelectro-hydraulic control sstemflhprssurefistastemuriletsigltadisonin DEHETSdthtulierthhatristifthratistettst power generation needs, significantly improving the economy and reliability of the units.

Concentrated Solar Power

Lanzhou Dacheng Dunhuang N50 MW Molten Salt Linear Fresnel CSP DEH+ETS Project

New Energy Demonstration Aids in the Achievement of Carbon Peaking and Carbon Neutrality

Project Background

LanzhouachenganMWmoltelineFreelsolathemalpwer generatiodemnstrationprjctisthewords fi commercialleinelathelweeratiorjteeetauefuleltdasti batchof destic solathmalereneratiodemnstratirjectsTheplanedinstaldcapacityof th projt ish pwerstatnaFreeentratilathemalhlywthpnentttulrrtytsandmll asauniftftit l for continuous output.It is a revolution in the energy production process.

System Application

HollSysrnsibforthesimletupplyandcmmissioninfanttaknldaysfrmh comisngoftherjtwithaltttheveralleratonfthystmfrpweeerationwhchprovsthatth concentratingsolthematlywthmlel asthehetolltionmedumhagodteicaldantaeTheyst officiallyput into commercial operation inJune 2020.

Combined Cycle Power Generation

Guangzhou Development Conghua Pearl Natural Gas Distributed Energy Station Project

Propels the Power Industry Towards a New Era of Stability, Reliability, and Self-Control

Project Background

The project is a 2x40 MW gas-steam combined cycle unit, which is a triple cogenerationunit. As the first demonstrationapplication of majrtehialqtthealizatfgbenratorfdistrteeyhisprtafetilreath monoplfforeafactureithupplfdistribtdenrgorequpmentestablihinependet prdtioandmaintea capabiltieorqpmnt anddimestdeltfeadyasurnthefdfdistutdeerth realizing the independent controllability of control system software and protection logic configuration technology.

System Application

Theentreiyi anitaiarytf thwlestatdpatfiuratf thgur CSEftstt peratthiiatlle pts disatchnCadqualfedpryfqencyreulatoabiehprjtasoffciallptitmercleratoni

Isolated Grid Coordination Control in High-Altitude Remote Areas

Ngari Regional UrbanInvestment Combined Heat and Power DEH + Isolated Grid Stability Control Project

Reliable and Efficient Solutions for Stable Power and Heat Supply

Project Background

NgarihqnCgeeratintraltiPrjtZhngCountytheoreareaoftheantaglatauntherthft Qinghai-Tibet Plateau,with an installed capacity of 2x6 MW.This project is important to ensure the safe and stable operation of central heating in Ngari Area.

System Application

Theprjet adsasetfintelint latedgridcrdnatioystmastestatinadfalt rltionitwhirat withDEandexcittiostmandsycizatndvitmleetfintlienlatdgridrdnat Theprojtcletdcnstrutiisnnganlatdgridtestnterandwasoffciallintratn

DEH Retrofitting

Datang Luohe Domestic System DEH Retrofitting Project

Supports Large Coal-Fired Power Plants in Control System Retrofitting

Project Background

DatangLuhePowerlantisonef themainpowerplantsinEastChinPowerGridheinstallecapacityof thethirdhase 2x630 MWandthitautiteronaryn thhanHayt, adopts ABBLC andtheMSapts SchneiderLCThyareallmorted control sstemsTheequipment isseriouslyaging th systemfalrthhanteratioanmantafthintgratedsstmrenit amandbt security risk and the risk of spare parts procurement of the imported system.

SystemApplication

All onadltlra systemsaarythnitilfullineratwiatladtheratiofthtrafot projetisttatfhattst fwethlyth industrialfdadaecalethmalwendstryhlgygeiridof thdeeenefthorethlgyfdest industrialontro ystsnforegotriandmainlLLAMCasbessulaldi supercritical thermal power units above 600 MW.

Services

Sincerely thank you forchoosing Hollys produts.While providing youwithadvanced products,wealoope tobring y industry-classsystem-levulfeyle servicesService guarantee incles ensurin th staleoerationof the systm providing continuous support, and effectively responding topotential risks. Ourservices mainly include the follwing:

■ Stable operation Thesystemust eabletoperate stablyforalongtietolminatesystemfalresrperfomance problemsinatielmaner Thisusuallyequireregulaystemmaintenancepdatesandmonitring,andtimelytroubleshootingandi
■ Technical support Tehcal ffeethwleredaf allle,teist etc,to solve problems existing in users'system operation.
■ Training guidance Necessar ran seicareproiddtreerstand andsthytmdproexeriead satisfaction.
■ Hardwaremaintenance Hardware spare parts can be maintained regularly.
一 Software application The software can be updated regularly.
■Upgrading Flexibleupgrading service solutionsareofferedtomeet operating environment andensurestableoperationneed.
■ Renovation Various upgrading needs of customers can be met,helping achieve the long-term goal of sustainable development.

Typical References

Key Accounts

Singapore
Changi Business Park Crescent,
#04-01/02/03 Plaza 8 @ CBP,Tower A,
Singapore 486025

China No.2 Di Sheng Middle Road, Economic-Technological Development Area, Bejing 100176

India D-84, Ground Floor, Sector 63,Noida, UttarPradesh201301

Indonesia Metropolitan Tower, 10th Floor Unit E JI. R.A. Kartini Kav. 14, Jakarta 12430

Uzbekistan
10,Mahmoud Tarabi
Street, Tashkent,
Uzbekistan