HANDBOOKFORTHE PETROLEUMAND PETROCHEMICALINDUSTRY

CONTENTS

#01 COMPANY INTRODUCTION ANDADVANTAGES

#O2 SPECIFIC SOLUTION#03 SUCCESS CASES

#01
COMPANY
INTRODUCTION
二

与70
0
0

LEADING BRAND OF INDUSTRIAL INTERCONNECTION

COMPANY INTRODUCTION

THEFIRSTGROUPOFCOMPANIES

Toentertheindustrialinterconnectionsector in China.

WITHOVER20YEARS

Of expertise in industrial-grade market, we have achieved the independent control of key

100+

Honors

Awarded "National High-Tech Enterprise”, "Shenzhen Independent Innovation Benchmark Enterprise”and more

300+ Intellectual Property (IP) Intellectual property rights, software, copyrights,invention patents,etc

52
Key Technologies
Possession of industry-leading key
technologies

3nedatawuddiqaterennhthcalaitlftoat enterpriancanlitdnthcitchationBordSMarktfShanghaiwsharesstokcod8 thnrardilliftl productiodsalfdtrwrandcaprteidlt philythatsi R&D.Haigdnaithdstrilgramart mrethayesthcrhnipt systt productsndstriltht itchdinstrilthtddernrtdstris prodttafptaritadstruht te countries and regions worldwide.

3ndthtflt capabitinthfdstrttdeffcnstewictloth industristttlgulhdiftri swithitatft haveeffectivlathstabitnefceyfesytieutiarthaicato haverankfithcathpttkaidactx intintetkitgidptstthtamantthtr tion and sustainable development of the global energy structure.

31%
TopTalents
Proportion of PhDs,Master's Graduates,
and Senior Expert Engineers in the
company

40% ProportionofR&DTalents Equipped with a first-class domestic R&D team of more than170 people,accounting for over 40% of the total workforce

17%
R&D Investment
R&D funds account for 17% of the
company's revenue

In the process of building a modern socialist country and achieving the "dual carbon" goals, the refining and chemical industry remains a pillar industry and will continue to maintain its dominant position in global energy for some time to come.

JONEDATA

Facing Challenges

Thinaliesdl tu uet ofenptp thechtthssttal facilitatecarbonemissionreductiontoensure thesuccessof enterprisesinthelow-carbontransformation.

Existing Opportunities

Ithtf enprgqp devqe grenrg bdgdfe caq bingnevtctztr stuuffq development from the era of capacity expansion and efficiency increase.

TSNEND-TO-ENDDETERMINISTIC NETWORKSOLUTION

The overall TSN network solution of 3onedata Communication includes: TSN terminal - side (TSN sensor, TSN network interface cards,SN terminal modules),SNnetwork(TSN switches,TSN5G gateways,TSNWiFi6 gateways), TSN control system, and TSN edge computing (edge computing gateways).

< Core Technologies>

<FutureNetworks>

Differentiated Services

Determinism

Low Latency

Serving the industrial Internet, it is applied in intelligent production,networked collaboration, service extension, and personalized customization, and is of great significance for promoting the development of China's industrial sector.

High Reliability

BlueEyesView
TSN Network
Management Systen

TSN Heterogeneous Industrial Protocol Management Systen

TSN Heterogeneous Industrial Equipment Management System

TSN Deterministic Scheduling System

TSNFULL-SERIESPRODUCTSPROVIDETSNEND-TO-END

HARDWARE ASASERVICE

HAASINDUSTRIALDIGITALINFRASTRUCTUREOPERATIONANDMAINTENANCEPLATFORM

HaaSplatformsoftwarefullnamendustrialDigitalnfrastructureOperationandMaintenancePlatform A digitalbasicsoftware andhardware infrastructure platform that helps industrialenterprises break through digitaltechnologybarriers,achieve rapid and low-cost equipment data collection,network constructionandmanagement,quipmentmonitoring andcontrol,informationsecurityprotection,and comprehensivevisualoperationandmaintenance.

mletlifareaaeastrtuelatvatltrstrutn devicemonitoring andcontrolinfrmatinsecurityprotection,andcomprehensivevisualperationandmantenance
·Protocolaccessupporting etConfodbusPC,Variousndustral agreemn
Equpinttstfpqpt operationstfurtqulrkdrtrtulislaydtlgydiagmacoringtthctult relatishtitstaftafisa
nteliertnntnftaltnqiltnn orderrftiuthertnfqpfa in a timely manner and repair them promptly
Digitalfttst the entire factory and park can be real-time integrated into the eye view
fomtneuritaplefcltinatafrtrevimrinndilawrtht
Datainteface,providing rich and comprehensiveRESful datainterface forthird-party systemintegration

<FEATURES>

Equipmentoperationand maintenancemanagement

BLUENMSNEWGENERATIONNETWORK EQUIPMENTINTEGRATEDMONITORING

BlueNMS

BlueNMShasbeenenhanced andexpanded invariousaspectssuchasdiscovery,display,monitoring,alam, and operation.Some functions have even been fully restructured,with the goal of managing allIT equipmentdatacenterdynamicenvironmentequipment,andserverapplicationsoftware,inordert providebasicservicesformodern petrochemicaland intelligentmanufacturingenterprises.

·Realize visualand centralized integrated monitoring and management of industrial Internet equipment
nteligrltiftrintn
eifalfi networkllnthtitdislarerkertitatteprinstrngta for customer network improvement and expansion
Dynaiiiniilataiinttntnitila the monitoring points, which will be automatically executed by the system
Distrtlytdldnetrgatstth networkmanagemetystemandpusheitasetstplgyandalamdatatthpevetwrmanagemetet
quialriitltirsie real-time dynamic updates of equipment alarm status, and displays fault details
emtsiqt analysis on devices

<FEATURES>

Intelligentadaptation

#02 SPECIFIC SOLUTION

LEADING BRAND OF INDUSTRIAL INTERCONNECTION

Land oil and gas fields

REFINERYNETWORK SYSTEM

GasFieldProductionNetwork Communication Solution

Solution Advantages

·Designed to meet EMC Class 4 standards, it can operate normally in environments with strong electromagnetic interference.
• With an IP40 protection rating, fan - less design, dual - power supply support, it can operate without failures.
•The product features high reliability and can work normally in environments such as high and low temperatures, humidity, salt spray, and dust.
·BlueEyes_View can intuitively monitor information such as the status of IP devices, link status, and bandwidth load rate in real - time.

Solution Features

·The solution adopts full - gigabit switches to enhance the real -time performance and reliability of data transmission.
·Designed with the SW - Ring network structure, and the network self - healing time is less than 20ms.
·Collect the production status of oil wells inreal- time, significantly shorten the time to detectfaults,andmproveworkefficiency

Transmission Network Solution for Oil and Gas Pipelines

Solution Advantages

·DesignedtomeetMCClassstandarditcanperateormallyinastrong lectromg netic interference environment.
·With an IP40protectionlevel fan-lss design,dual-power supply support, and can work without failure.
·The product has high reliability and can operate normally in environments such as high and low temperatures, humidity, salt spray, and dust.
•It meets the special environmental requirements of industrial sites and has flexible interface configurations, installation methods, power supply methods, and networking methods. ·BlueEyes_View can intuitively monitor information such as the status of IP devices,link status, and bandwidth load rate in real - time.

Solution Features

·The backbone network for oil and gas pipeline monitoring adopts the SDH optical network to detect parameters such as the pressure, flow rate, and temperature of oil and
gas pipelines, ensuring the safe and reliable operation of oil/gas pipelines.
·The on - site control part adopts a communication transmission method with link
redundancy of “industrial Ethernet + GPRS” to ensure that the communication of oil and
gas pipelines can adapt to more scenarios.
·The pumping station aggregation part uses a Gigabit Ethernet network, which can accurately grasp the productionstatus of oil wells significantly shorten the time to detect
faults, and improve work efficiency.

REFINERYNETWORK SYSTEM

Application andCommunicationSolutionsfor Oil and Gas Pipeline Monitoring System (SCADA)

Ethernet

Solution Advantages

Solution Features

·The data acquisition and monitoring control system adopts a networking method with dual - core and redundant links of access - layer devices, ensuring the reliability and stability of the network at the core layer and the access layer.

· When a link of the access - layer device malfunctions, it will automatically switch to the other link, and the self - healing time is less than 20ms. This will not affect the SCADA monitoring system, ensuring the stable transmission of system data. ·The core adopts a hot - standby method for redundant backup. When the primary core fails, the standby core will automatically switch to the primary core, achieving redundancy at the gateway.According to the actual application situation on - site,the network can be optimized to achieve load sharing.

Application and CommunicationSolutionsforDistributed Control System (DcS) in Refining and Chemical Industry

Solution Advantages

·3onedata - Ring can provide a recovery time of less than 20ms. ·The switch supports a variety of security functions. It can support Dos attack protection and original MAC address security protection without configuration. ·It supportsmultiple standardredundant ring networkfunctionsMRPRPS,enabling joint networking with most manufacturers in the market. ·3onedata supports in - depth customization services. It can customize communication equipment in multiple dimensions according to the requirements of DCS manufacturers.

Solution Features

•The complete set of DCS is connected to the joint control center with dual - network and dual - set redundancy. ·One database server is configured. Through configuration, the production data of each unit is centralized. Two dispatcher operation stations are configured and connected to this database server, responsible for monitoring all units in the center. ·Two ICS5556 switches are configured to connect the DCS systems of each unit. At the same time, they are connected to the production dispatching and command center of the whole plant, responsible for uploading production data.

ApplicationandCommunicationSolutionsfor Safety Instrumented System (SIS)

Solution Advantages

· SW -Ring can provide a recovery time of less than 20ms. ·The switch supports a variety of security functions. It can support Dos attack protection and original MAC address security protection without configuration. · It supports EMC Level 3 or Level 4 protection certification.

Solution Features

·The SIS device is connected to the network cabinet in the FRR equipment room via a dual - line chain, with dual - network and dual - link redundancy. ·Equipment such as operator stations, engineer stations, monitoring & surveillance devices are also connected to the core switch via dual - lines. ·The core switch ICS5556 has a three - layer routing function to partition the broadcast domain. Network segments are divided according to different technological sections and different types of equipment, and communication is carried out through routing. ·The two - layer communication switch IES6300 Server Plus is used to connect the control equipment in each FRR room.

Application and Communication Solutions for Closed - Circuit Television Monitoring System (CCTV)

Solution Advantages

·Simple structure, fewer devices, and the lowest investment.
• With link redundancy function, the network reliability is significantly improved.
·No root bridge bottleneck exists.
· Short network self - healing time (20 milliseconds).
·Reasonably set uparedundancymanagerto achieve networkload balancing.

Solution Features

·Adopt a ring - shaped network structure with a network self - healing time within 20ms.
·Connect thecentral corenodes andeachlower-layeraggregationnode inseriestoforma ring. Thus, based on cost - saving, the network system has a good link redundancy function.
·There are a large number of video surveillance cameras, generating huge data traffic. The designof a10Gigabitnetwork architecture canfullymeet therealtime,reliability,and stability requirements of the CCTV system.
·The ring - shaped network has a good link redundancy function. When a link in the network system fails and disconnects, the single - ring structure will automatically switch to the standby link, turning into a single - star structure, without affecting the normal communication of the entire network system.

PRODUCTINTRODUCTIONT

ICS5400SL Series

·Supports 24 Gigabit electrical ports (PoE optional) and 4 10 - Gigabit SFP+ slots.
·Supports MRP ring network, and the re - configuration time is < 200ms.
·For 48VDC products,the maximum PoE power of the whole machine is 720W; for110/220VAC products, the maximum PoE power of the whole machine is 360w.
·DC non -PoE products support two - way 24/48VDC(18-72VDC), dual- power redundancy, and support non - polar connection; PoE products support two - way 48VDC (44 - 55VDC), dual - power redundancy, and support reverse - connection protection.
·AC non - PoE products support two - way 110/220VAC (85 - 264VAC), dual - power redundancy; PoE products support one - way 110/220VAC (100 - 240VAC).
·Supports an operating temperature range of - 40 to 75°℃.
·Supports an IP40 protection level (non - PoE).

IES6300SLSeries

·Support 2 Gigabit SFP slots and 4 Gigabit copper ports (optional PoE),4 Gigabit SFP slots and 8 Gigabit copper ports (optional PoE) or 4 Gigabit SFP slots and 16 Gigabit copper ports (optional PoE)
·Adopt Ring patented technology, support singlering,coupling ring,chain,Dualhoming function
Supportmultiplenetworkprotocolsandindustry standardssuchasSTP/RSTP/MSTP PoE, DHCP, VLAN, QoS, IGMP Snooping, LLDP, ACL and SNMP.
· In PoE products,the maximum power consumption of 6 ports is 120W, and that of 12/16 ports is 240W
·Support dual powerredundancy.The input voltage of non-PoE products:12\~60VDC,and that of PoE products: 44\~57VDC
·Support-40\~75°℃ wide operating temperature range

ICS6400BT-8GP4XSSeries

· Supports 8 Gigabit PoE electrical ports, 4 10 - Gigabit SFP+ slots, and 1 USB port.
·Adopts patented Ring network technology,supporting single-ring,coupled -ring,chainring, and Dual - homing ring network functions.The automatic recovery time from network failures is < 50ms.
· Supports PoE power supply. The maximum output power per PoE port is 9oW, and the maximum output power of the whole machine is 360W.
·Supports two -way 48VDC (44 - 57VDC), dual - power redundancy,and reverse - connection protection.
·Supports operation in a wide temperature range from - 40°C to 75°℃.

IES6300-8GP2GS2HSSeries

·Support 2 2.5G SFP slots, 2 Gigabit SFP slots and 8 Gigabit copper ports
·Adopt Ring patented technology, support single ring,coupling ring,chain,Dual-homing, automatic recovery time of network failure \prec 20ms
·Support multiple network protocols and industry standards, such as STP/RSTP/MSTP, ERPS, DHCP, VLAN, QoS, IGMP Snooping, LLDP, ACL and SNMP.
·Support 2 optional input power supplies: 48VDC, 220VAC/DC
·Support -40\~75°℃ wide operating temperature range

IES6000-8GT2HSSeries

·Support 2 2.5G Ethernet SFP slots and 8 Gigabit copper ports
·Adopt SW-Ring patented technology,support singlering,coupling ring,chain,Dual-homing ring, automatic recovery time of network failure <20m s
** Support multiple network protocols and industrial standard, such as STP/RSTP/MSTP, ERPS, DHCP, VLAN, QoS function, IGMP Snooping function, LLDP etc.
·Support dual power redundancy, input voltage 12\~48VDC
·Support -40\~75°C wide operating temperature range

MES5300-24GT4GSSeries

·Support 24 Gigabit copper ports and 4 Gigabit SFP slots
·Support MRP ring network,reconfiguration time < 200ms
·Support multiple network protocols and industrial standards, such as ARP, STP/RSTP/MSTP, ERPS, VLAN, LACP, IGMP Snooping, LLDP, SNMP, etc., support Modbus TCP monitoring instruction of electricity SCADA system
·DC product supports 2 24/48VDC (18-72VDC), dual power supply redundancy, support non-polarity
·AC product supports 2110/220VAC/DC(85-264VAC/77-300VDC),dualpower supply redundancy
·Support-40\~85°℃widetemperatureoperation,supportlevel4electromagneticcompatibility protection, and conform to IEC 61850-3 and IEEE 1613 (substation) standards

MES5200Series

·Support 16 Gigabit copper ports, 8 100M fiber ports and 4 Gigabit SFP slots
·Support MRP ring network, reconfiguration time <200m s
· Support multiple network protocols and industrial standards, such as ARP, STP/RSTP/MSTP, ERPS, VLAN, LACP, IGMP Snooping, LLDP, SNMP, etc., support Modbus TCP monitoring instruction of electricity SCADA system
·DC product supports 2 24/48VDC (18-72VDC), dual power supply redundancy, support anti-reverse connection
·AC product supports 2 110/ 220VAC/DC( 85-264VAC/77-300VDC), dual power supply redundancy
·Support -40\~85°℃C wide temperature operation, support level 4 electromagnetic compatibility protection, and conform to IEC 61850-3 and IEEE 1613 (substation) standards

MES6400PHR-8GT4XS Series

· Support 8 10/100/1000Base-T(X) Ethernet copper ports and 4 10Gigabit SFP+ slots
·Support Precision Time Protocol(PTP), provide sub-microsecond synchronization accuracy to meet requirements for high-precision time synchronization
·Support IEC61850-MMS, ensuring the efficient, reliable and standardized communication between substation devices
·Support MRP ring network, reconfiguration time \angle 200ms
·High voltage input products support 110VDC or 220VAC/DC; Low voltage input products support 24/48VDC dual power input
·Support -40\~75°C wide operating temperature range

PRODUCTINTRODUCTIONT

ICS6420Series

·Support 4 10Gigabit fiber ports (SFP+ slots), 8/12 Gigabit copper ports, 4/8 Gigabit SFP slots
·Adopt SW-Ring patented technology, support single ring,coupling ring,chain,Dual-homing, automatic recovery time of network failure <20ms
·Support ERPS and loop detection, which can eliminate loop effectively and prevent broadcast storm caused by data loop
·10 Gigabit bandwidth can transmit large amounts of video, voice and data with high performance and high speed
·Support dual DC power redundancy, input voltage: 12\~48VDC
·Support -40\~75°C wide operating temperature range

ICS5530Series

·Support 6 10Gigabit fiber ports (SFP+ slots),8 Gigabit Combo (SFP slots or RJ45),16 Gigabit
SFP slots
·Adopt SW-Ring patented technology, support single ring,coupling ring, chain ring, Dual-homing ring network function, automatic recovery time of network failure < 20ms
·Support DC orAC dual power(optional),input voltage: 18\~72VDC or 100\~240VAC/DC
·Support -40\~75°℃ wide operating temperature range

ICS5556series

·Support 8 10Gigabit SFP+ slots and 4 board card slots which can match 12 Gigabit SFP slot board cards or 12 Gigabit copper port board cards (optional)
·AdoptRingpatentedtechnologysuport singleringcoulingringchinuloming functin
·Support ERPS and loop detection,which can eliminate loop effectively and prevent broadcast storm caused by data loop
· 10 Gigabit bandwidth can transmit large amounts of video, voice and data with high performance and high speed
·Support AC redundant power supply,input voltage:100\~240VAC
·Support -40\~60°C wide operating temperature range

ICS6400TSN series

· Support 4 10G SFP+ slots and 8 or 16 Gigabit copper ports
·Support Precision Time Protocol(PTP),provide sub-microsecond synchronization accuracy to meet requirements for high-precision time synchronization
·Support TSN (time sensitive networking) protocol standards such as IEEE802.1AS, IEEE802.1Qbv, IEEE802.1Qbu, IEEE802.1CB, IEEE802.1Qci and IEEE802.1Qcc, which can provide deterministic transmission with low delay and high reliability for data
·Adopt Ring patented technology, support single ring,coupling ring, chain,Dual-homing, automatic recovery time of network failure \prec 20ms
·Support dual power redundancy, input voltage 12\~48VDC
·Support -40\~65°℃ wide operating temperature range

ICS5000-M Series

** Supports STP/RSTP/MSTP protocol, VRRP protocol, as wellas simple and efficient redundant protection mechanisms such as ring network protection, dual uplink primary and backup link protection, LACP link aggregation,etc
·Supports static routing, RIP, OSPF, VRRP routing protocols
·Advancedhardwarearchitecturedesign,hardwareimplementationforhierarchicalscheduling and protection of messages, support for preventing attacks on devices such as DoS and TCP SYN Flood, UDP Flood, broadcast storm, and high traffic
·Supports input voltage of 100-240VAC
·Support working temperature of 0-40°C

GW1100-2T-16D(3IN1)-RJ-OLED-2P(85-265VAC)

· Supports conversion from 16 - channel 3IN1 serial ports to 2 - channel 10/100Base - T(X) auto - adaptive Ethernet interfaces.
·Supports conversion between Modbus RTU/ASCll and Modbus TCP protocols.
·Supports multiple operation modes such as RTU Master, RTU Slave, ASClMaster, and ASCll Slave.
·Supports virtual ID and real ID mapping, enabling flexible access between master and slave devices.
·Supports network modes like redundant mode, switching mode, and dual -IP mode to meet various network environment requirements.
·Supports dual - power supply with a wide voltage input range of 85 - 265VAC.
·Supports operation in a wide temperature range from - 40°C to 75°℃.
· Supports an OLED display for configuring device information.

IGW1111/IGW1112/IGW1114Series

** Supports 1/2/4 channels of 3IN1 serial ports and 2 channels of 10/100Base - T(X) auto - adaptive Ethernet interfaces.
·Supports the conversion between Modbus RTU/ASCll and Modbus TCP protocols.
·Supports multiple operation modes such as RTU Master, RTU Slave, ASCIlMaster and ASCIISlave.
·Supports the mapping of virtual ID and real ID, enabling flexible access between master - station and slave- station devices.
·Supports network modes such as redundant mode, switching mode and dual - IP mode, meeting the needs of various network environments.
· Supports dual - power input of 12 - 48VDC.
·Supports operation in a wide temperature range from -40°C to 75°℃.

RIO1000

·Supports 2 channels of 10/100Base-T(X) auto - adaptive Ethernet interfaces.
·Supports the Modbus TCP protocol. The DI channels, DO channels and device system information can be managed via Modbus TCP Master.
·Supports customizing the Modbus TCP Slave register addresses,facilitating theupgrade and transformation of industrial field systems.
·Supports operating modes such as Dl, Counter, DO and Pulse Output.
·Supports network modes like redundant mode, switching mode and dual - IP mode to meet the requirements of various network environments.
· Supports power input ranging from 12 to 48VDC.
·Supports operation in a wide temperature range from-40°C to 75°℃.

CP202-2CI

· Supports the conversion from 2 channels of CAN to 1 channel of 10/100Base - T(X) auto - adaptive Ethernet interface.
·Supports multiple working modes such as CPServer,TCP Client, UDPServer, UDP Client, UDP Rang and UDP Multicast.
·Supports any baud rate from 5K to 1000Kbps.
·Supports operation in a wide temperature range from-40°C to 75°℃

#03 SUCCESS CASES

LEADING BRAND OF INDUSTRIAL INTERCONNECTION

30NEDATA

SUCCESS CASES

01. Xinjiang Karamay Oil Production Detection Project
02.National PipelineNetworkFramework:GuangdongProvince Natural Gas Pipeline“County-Coverage Project”Shaoguan-Ruyuan Project Flow Meter Measurement System and Pressure Control System Engineering
03. National Pipeline Network Fujian Natural Gas Pipeline Phase ll Project: Zhangzhou LNGInterconnection LinePressure Regulation and Metering SystemEngineering
04. West-East Gas Pipeline 2021 Yangpu Petrochemical Functional Zone Natural Gas Pipeline Gas Quality Measurement System Engineering
05.National Pipeline Network 2022 Framework:Western Pipeline Tarim Oil& Gas Transmission West Line 1 Hongliu Compressor Station Fuel Gas Metering,Heating,and PressureRegulationSkidApplication
06. Southwest Oil & Gas Field Gas Production Plant No. 2 Surface Gathering and TransportationSystem
07. Jinling Petrochemical Power Monitoring System
08.GuizhouKailiOil Depot InformatizationUpgradeProject
09.2022 NationalPipeline Network Framework:West-East Gas Pipeline Xiantao-Qianjiang InterconnectionLine Metering SystemEngineering
10. Bangladesh Compressor Station Metering System Instrumentation and Metering Cabinet Application
11. National Pipeline Network Framework: West-East Gas Pipeline Company Zhongkai Line-Pingtai Line Interconnection Project Metering Skid and Pressure Regulation Skid Application
12.Yanchang Oilfield Xingzichuan Production Plant Maozhuangke Area Oil Well DigitalizationConstructionProject
13. Southwest Oil& Gas Field Sichuan Guangyuan Jiange Block Reef-flat Gas Reservoir Pilot Production Surface Engineering SCADA and CCTV Systems
14. China-Russia Eastern Pipeline Metering System Project: Kedong StartingStation,KeshanDistributionStation,YianDistributionStation, andFuyuPiggingStation Metering CabinetApplication
15. National Pipeline Network Fujian Natural Gas Pipeline Phase ll Project: Zhangzhou LNG Interconnection Line
16. China-Russia Eastern Pipeline Metering System Project: Kedong StartingStation,KeshanDistributionStation,YianDistributionStation and Fuyu Pigging Station Metering Cabinet Application
17. National Pipeline Network Framework: Shandong Operation and Maintenance Pingtai Line Jining Station Metering Cabinet Application
18. Jieneng Thermal Gas Pressure Regulation Station Skid-mounted EquipmentProcurementandStationControl SystemApplication
19. Gansu Changqing Oilfield Hydropower Plant Qiaohe, Xizhangyuan (Liumaoyuan), and Tianxingbei Substation Projects
20. Shanghai Petrochemical No. 1 Chemical Substation Background Monitoring System Engineering
21. Shanghai Petrochemical Refining Department No. 2 Ethylene Substation Project

Dear Partners,

Greetings!

When we drink water, we should think of its source and never forget our original aspiration. The development and growth of 3onedata would not have been possible without your trust and support. Looking back on the journey of more than two decades, we have basked in sunlight and weathered the wind and rain. A simple "thank you" is not enough to express our gratitude and respect for you.

In the years to come, 3onedata will always adhere to the business philosophy of "linnovation I Value I Glory," continue striving and providing you with high-quality services.

We look forward to working hand in hand with you to create brilliance together.

SONEDATA

3onedata Co., Ltd

Add:3/B,Zone 1,BaiwangxinHigh TechnologyIndustrial Park, XiliStreet,NanshanDistrict,Shenzhen,518105,China
Web:www.3onedata.com
Tel:+86-755-26702688ext.826
E-mail:marketing@3onedata.com
Copyright ⊚ 3onedata Co., Ltd. All rights are reserved.