AX15o0 Series Professional 1500ST|1500S|1500T|1500D|1500C

Product User Manual Product Specification

Dongguan Hangyuan Hardware Tools Co., Ltd.

General safety warnings for mechanical equipment

Read all warnings and all instructions.Failure to follow the following warnings and instructions will result in electric shock, fire and/or serious injury. Keep all warnings and instructions for future reference.

GeneralMechanical EquipmentSafetyWarning-Work Area

1) Keep theworkplace cleanandbright.Amessyand dark place is likely to cause accidents.

2)Do not operate the beveling machine in an explosive environment,such as where there are flammable liquids,gases or dust.The sparks generated by the beveling machine may ignite the dust or gases.

3) Operate the beveling machine after children and onlookers have left.Inattentiveness may cause the operator to lose control of the tool.

General Mechanical Equipment Safety Warni ng-Electrical Safety

1)Theplugof thechamferingmachinemustmatch the socket.Itisstrictlyforbiddentomodifythepluginany way.Electrictools that need groundingcannot useany adapterplugs.Unmodified_plugsandmatching socketswillreducetheriskofelectricshock.
2)Avoidcontactofthehumanbodywith_grounded surfacessuchaspipes,heatsinksand_refrigerators. Contact of thebodywith the groundwill increase the risk of electricshock.
3)Do notexpose_this equipmentto rain or damp environments.Waterenteringtheequipmentwill increasetheriskofelectricshock.
4) Do not overusewires.Do not use wires to move,pull theeguipmentorunplugitsplug.Keep thewiresaway fromheatsources,oil,sharpedges.ormoving.parts. Damaged ortwistedflexiblewireswillincreasetherisk ofelectricshock.
5)When usingthe equipment outdoors,use external flexiblewiressuitable'foroutdooruse.Suitable outdoorflexiblewireswill reducetheriskof electric shock.
6)If it is inevitable to operate_thisequipment ina humidenvironment，aresidual.currentaction protector (RCD) shouldbeused.Usingan RCDcan reducetheriskofelectricshock.

General Machinery Safety Warning-Personal Safety

1)Stay alert.When operating this equipment,focus on the operation you are undertaking and stay clear-headed.Do not operate this equipment when you feel tired,or when you are under the influence of drugs,alcohol or treatment reactions.A momentary lapse of attention during operation of this equipment can lead to serious personalinjury.

2)Use personal protective equipment.Always wear goggles. Safetydevices,such as dust masks,slip-resistant safety shoes, safety helmets,hearing protection devices,etc.，used under appropriate conditions can reduce personal injury.

3) Do not stretch your hands too far.Always pay attention to your footing and body balance.This will enable you to control the equipment well in case of an unexpected situation.

4) Remove all adjustment keys or wrenches before the power of the equipment is connected.Wrenches or keys left on the rotating parts of the equipment can cause personal injury.

5) Dress appropriately.Do not wear loose clothes or accessories. Keep clothes,gloves and hair away from moving parts.Loose clothes,accessories and long hair may get caught in moving parts.

6) If you purchase devices for connecting to the chip removal and dust collection equipment，make sure they are properly connected and used correctly. Using these devices may reduce the risks caused by dust.

Mechanical equipment usage a nd precautions

1) Do not misuse this equipment. Use the appropriate mechanical equipment for the intended purpose.Selecting the appropriatelydesigned mechanical equipment will make your work more efficient and safer.

2) If the switch cannot be turned on or off to cut off the power supply of the tool,then this equipment cannot be used. Equipment that cannotbe controlled by the switch is dangerous and must be repaired.

3)Before making any adjustments,replacing accessories or storing the equipment,the plug must be unplugged or the power disconnected from the power source.This protective measurewill reduce the risk ofaccidental start-up of the tool.

4) Store the idle equipment out of the reach of children and do not allow people who are not familiar with this equipment or do not understand these instructions to operate the equipment. Mechanical equipment in the hands of untrained users is dangerous.

5) Maintain the equipment.Check whether the moving parts are adjusted properly or stuck,and check fordamage to the parts and other conditions that affect the operation of the equipment. If there is damage,the equipment should be repaired before use.Many accidents are caused by poorly maintained mechanical equipment.

6) Keep the cutting tools sharp and clean.Well-maintained tools with sharp cutting edges are less likely to get stuck and easier to control.

7) Use the equipment,accessories and tool heads according to the usage instructions,considering the working conditions and the operations being performed.Using the equipment for operations thatdo notmatch the purpose may lead to danger.

General Safety Warning for Elec tric Tools - Maintenance

Note:Have yourequipmentsentto professionalmaintenance personnelforrepair.Use the same spare parts for the repair. Thiswill ensure the safety of the repaired equipment. 1) Before conducting any debugging or maintenance work on theequipment, please make sure to disconnect the power supply of the equipment first. 2) Personnel without the ability to perform maintenance or without maintenance experience are not allowed to participate in the maintenance of this equipment.

Supplementary Safety Rules forAngle Grinder Special requirements forchamferingoperation

1) Keep the equipment placed steadily. Check if the four feet are level and parallel. Placing the equipment steadily can enhance the stability of the machine.

2) Keep your hands away from the rotating parts.

3)Please install the chamfering tool bits before using.

4)Keeptheworkpiecestable.Holdtheworkpiececorrectlywith both hands and advance it slowly and steadily forward.Do not bring your face or hands close to the rotating parts during operation.

5)Do not process materials containing asbestos.Asbestos may cause cancer.

6)The edges and fragments of the workpiece are very sharp.Please wear protective equipment. Depending on the applicable situation, use a face mask,safety goggles orsafety glasses.When applicable, weara dust mask,hearing protection device,gloves and a work apron that can prevent workpiece fragments.

7)Keep a certain safe distance between bystanders and the working area.Anyone entering the working area must wear protective equipment.

8) The workplace must be kept clean.Different types of work dust, after being mixed,are prone to chemical reactions and are very dangerous.Metal dust is prone to catching fire or causing explosions.

9) Do not let the tools run without anyone present. Only operate when the tool needs to be chamfered.Before the power supply of the equipment is connected,remove all adjustment keys or wrenches.Wrenches or keys left on the rotating parts of the equipment can cause personal injury.

10)Do not place the chamfering machine on the workpiece fragments.Otherwise，it may cause damage to the tool or malfunction.

11)Please avoid the rotating parts of the machine touching the power cord,which may lead to a serious electric shock accident. Do not use a chamfering machine with damaged power cords. If the power cord is damaged during operation，do not touch the damaged wire and immediately pull out the plug. Damaged wires will increase the risk of electric shock for the user.

12)During operation,it is strictly prohibited to disassemble or adjust the operation.Do not touch the rotating knife shaft with your hands.

To avoid the risk of cuts,do not touch the working blade of the machine.

Marking

13) Do not touch the blades immediately after operation. Because they may be extremely hot and cause burns to the skin.

14) Do not collide the workpiece with the worktable surface.Do not start the equipment with a load.

15) When using an extension cable,please use the double-insulated cable with the same specifications as this equipment.

16)Regularly clean the iron filings and dust on the equipment. Excessive iron filings and dust deposition can lead to electrical hazards.

17) The workpiece should be moved steadily and uniformly forward in the specified moving direction.The size of the workpiece should be such that the operator can control it and not fall into the slot of the worktable.

18) Do not process steel that has undergone heat treatment. Do not process workpieces witha hardness greater than HRC42 after quenching or other materials with a hardness greater than HRC42.

To minimize the damage,users should carefully read the instruction manual.

Warning sign

心 4 口 O 0O

Double insulation

Please wear ear protection.

Please wear protective glasses.

Please weara dust mask.

Before carrying out any debugging ormaintenanceworkonthe machine,please be sure to unplug the power plug first.

Compound slide chamfering machine function instruction

AX150os (without slide rail function)

Some of the accessories mentioned in the illustrations or text are not included in the scope of supply.

The main application of this equipment

TheAX1100STtypehigh-speedcompoundsliderailchamferingmachineisanewtypeofeficientandmuli-functionalbenchtop equipmentspeciallydesignedforchamferingoperations.Itcanperformhig-speedchamferinganddeburingonstraightedgesand iregularcurvededgesofmetalpartsaswellaschamferingandchamfersopeprocessngItismainlypiedtothecameringof machinedpartsiustrcheacalpocesigoldaucturigdulicvetalpocingfgs shipbuilding.

The performance features of this equipment

.)Thismachinecanbeequppedwithdiferentpesofbladestoperforchamferingprocessingonmetalpartsofvariousmaterials.The eplacementofthebladesiscarredoutusingaspecialhexagonalsocketwrench,whichissimpleandconvenienttooperate.

2)Equippediteooellcurefamctalliggtdd rotational speed of the knifeshaft is high,and the surface finish of the processed parts is good.

3)Itdoptsimpoedigbdesithgrngtrpesdearesistaechvelogeielifrelibeable in operation,and have high production efficiency

4)Thismachinecanbeusedforbothstraightedgechamferingandcurvededgechamferingeducingtheconfigurationcostofteachine 5)The chamfering size can be adjusted within the range of 0 . 5 \mathsf {mm } (for the straight part) or 0 { - } 2 \mathsf {mm } (for the curved part),and the operation is simple,convenient and easy to use.

Machine specifications

We recommend that you choose your accessories from the store where you purchased this chamfer.Please select the right attachment foryour job.

Operation Instructions

Before using the machine,please read the instruction manual carefully. 1.Locking handle (see Figure B)

The stop handle b1 is only used when there is a need for fixed positioning of the sliderail function,during equipment transportation,and when performing inspection,maintenance or replacing the blade.When using the new machine, please rotate the handle counterclockwise to release the stop to enable the use of the slide rail function.

Note: This information can be ignored for non-slide rail beveling machines.

Il. Startup/Shutdown (See Figure C)

Note: Before connecting the device to the power supply,make sure to check and confirm that the switch is in the off position.

Power On: Press the"1"end of the switch to start the equipment

Power Off: Press the " 0 " end of the switch to turn the equipment off.It is in the off state.

Ill.Replacementand Installation ofBlades Warning: Please ensure to use the original AOCKE brand blades for the knife blades.

Note: When replacing the blade,please ensure that the machine is turned off and the power plug is unplugged.

Before using the machine,please check if the blade is worn.Worn or bluntblades willaffectthechamfering effectand shorten the service lifeof themachine.

The output shaft of the knife holder is equipped with 3 blades (straight part),and each blade has 4 cuting edges.When the cutting edges of the blades become blunt,please rotate both sides of the blades by 9 0 ^ { \circ } to use the new cutting edges. When all 16 cutting edges of the 3 blades become blunt,please replace the new blades.

Note: The curved part is equipped with 2 blades,and each blade has 2 cutting edges.

Please follow the following steps each time you replace the blade.

1. Operation steps for the linear part of the slide rail (refer to Figures D and F) a) Remove dl,d2,d3,and d4 screws one by one.
b) Remove the guide plate d5 and the front dust shield d6 respectively.
c) Use the included T20 wrench to remove the star-shaped screws f2 that fasten the blade.
d) Rotate the cutting edge or replace the blade fl.
e) Finally, reinstall the guide plate d5 and the front dust shield d6 in sequence. Note:This operation step is applicable to AX1500ST and AXl500T; zhu 2. Operation steps for the non-slip rail straight section (refer to Figures Eand F) a) Remove el,e2,e3,and e4(four screws) one by one.
b) Remove the guide plate e5 and the front dust shield e6 respectively.
c) Use the included T20 wrench to remove the star-shaped screws f2 that fasten the blade.
d) Rotate the cutting edge or replace the blade f1.
e) Finally,reinstall the guide plate e5 and the front dust shield e6 in sequence. Note:This operation procedure is applicable to AX1500S and AX1500D;
zhu

Figure B:Sliderail- stopper h andle

Figure C:Start switch

Figure D:Linear part of the sl iderail

Figure E: Non-sliding rail stra

Figure F: Straight-line se ction knife shaft

Figure G: Curve section knife shaft

Figure H:Linear part of thesliderail

Figure I: Non-sliding rail straight section

3.Operationsteps for the curved part (referto FiguresDand G)

a) Rotate the arc guiding plate d7 counterclockwise until it is removed. b) Remove the hexagonal screws g2 that fasten the blade using the included T8 wrench.

c) Rotate the cutting edge or replace the blade gl.

d) Finally, reinstall the guiding plate d7.

Note:This operation procedure is applicable to:AX1500ST,AX1500S,AX1500C.

IV.Adjusting the Size of Chamfers

Note: Before adjusting or inspecting the equipment, please make sure that the machine has been disconnected from the power supply.

If the required chamfer size is above C2,please complete it in multiple steps. It is recommended to increase by 1 - 2 \mathsf {mm } each time. Otherwise,it will reduce the surface quality of the processed part,shorten the service life of the machine and increase the wear of the cutting tool.If the chamfer requirements are too high, please perform trial chamfering until they meet the requirements.

Note:The single feed of the straight section is less than 2 \mathsf {mm } ,and the single feed of the curved section is less than 1mm;

1. Operation steps for the linear part of the slide rail (refer to Figure H)

increase in \lnsim Reduction of cutting volum cutting volume

a) Rotate counterclockwise and release the two fixed handles h1 on the left and right.

b) Adjust the chamfer size by rotating the two adjusting handles h2 on the left and right. During the adjustment, both the left and right adjusting handles h2 should be operated simultaneously.

c) When rotating counterclockwise,the cutting amount decreases; when rotating clockwise,thecuttingamount increases.

d) Adjust to the desired size and then lock the fixed handle h1

Note:This operation procedure isapplicable to AXl50oSTand AX1500T.

2.Operation steps for the non-slip rail straight section (refer to Figure l)

increase in G Reduction of cutting volume cutting volume

a) Rotate counterclockwise and release the two fixed handles il on the left and right.

b) Adjust the chamfer size by rotating the two adjusting handles i2 on the left and right.During the adjustment,both the leftand rightadjusting handles i2 should be operated simultaneously.

c) When rotating counterclockwise,the cutting amount decreases; when rotating clockwise,thecuttingamount increases.

d)Adjustto the desired size and then lock the fixed handleil.Note: Thisoperation procedure isapplicable to AX1500Sand AX1500D;

3.Operation steps for the curved part (refer to Figure J)

Increase in Q Reduction of cutting volume cutting volume

a) Rotate the arc guiding plate jl counterclockwise until it is loosened.

b) At this point, rotating counterclockwise will reduce the cutting amount,while rotating clockwise will increase it.

c) Adjust to the desired size.Then,rotate the adjusting ring j2 to make it tightly contact the arc guiding plate jl until it is tightened.

Note:This operation step isapplicable to:AX1500ST,AX1500S,AX1500C.

V. Instructions for Chamfering Operation

Note: Excessive miling operations may cause machine overload,blade damage and poor surface quality of the machined parts.Therefore,for milling operations, the feed per stroke of the straight section should not exceed 2mm,and that of the curved section should not exceed 1mm. Multiple strokes of machining can be carried outto achievea greatermilling effect.

Warning:This machine operatesata high speed and should notbe used for processingultra-thin and ultra-small workpieces.When chamfering,do not touch the rotating spindle while it is runningat high speed.

1. Operation steps for the linear part of the slide rail (refer to Figure K)

a) Firstly, start the equipment and wait until it reaches the maximum speed.

b) According to the length of the workpiece k2,pull the slide rail to obtain the appropriate travel length of the workpiece k2,so that one side of the workpiece k2 is in contact with the travel block kl.

c) Place the workpiece k 2 above the linear worktable surface according to the above conditions without allowing the blade to have any contact with it.

d) Press the workpiece with both hands and push the slide rail,advancing slowly forward in the feeding direction.At this time,it is required to keep the surface of the workpiece k2 parallel to the guide panel and advance at a uniform speed until the final milling is completed.

Note:This operation step isapplicable to AX1500STand AX1500T;

2.Operation steps forthe non-slip rail straight section (refer to Figure L)

a) Firstly, start the equipment and wait until it reaches the maximum speed.

c) Place workpiece ll above the worktable of the straight section without allowing the blade to come into any contact with it.

d) Press the workpiece with both hands and slowly advance it forward along the direction indicated by the arrow on the worktable surface.At this time,it is required to keep the surface of workpiece l1 parallel to the guide panel and advance it at a uniform speed until the final milling is completed.

Note:This operation procedure isapplicable to AX150oS and AX1500D

3.Operationstepsfor thecurved part (referto Figure M)

Note:When chamfering the inner hole or long groove,the diameter of the hole or the width of the groove should be larger than the outer diameter of the guiding bearing!

a)First, start the equipment and wait until the equipment reaches maximum speed.

b)Place the workpiece ml above the curved part of the worktable without allowing the blade to come into contact with it.

c) Use both thumbs to gently push the workpiece towards the spindle and hold it down.Do not apply excessive force or force too abruptly to avoid damaging the guide wheel bearing on the spindle.

d)When processing the inner hole,the workpiece itself does not rotate,but the workpiecemovesuniformlyclockwisearoundthespindle.

e)When chamfering the outer round edge,the workpiece rotates counterclockwise.

f)Finally,rotate the workpiece around the spindle for1 to 2 turns to complete the chamfering.

Note:This operation step isapplicable to:AX1500ST,AXl500S,AX1500C.

Figure J: Curved section

Figure K:Straight Sectio nofSlideRail

Figure L: Non-sliding rai lstraight section <br>Figure M:curved section

5

When machining the inner hole, theworkpiecemoves clockwise.

Q

Whenmachining the outercircle, the workpiece rotates counterclockwise.

Note: During processing,one should follow the principle of small feed and slowspeed to achieve the bestchamfering effect.

Figure N: Curve sectiongu ide wheel

Figure O:Ventilation ope ning

Figure P: Non-sliding rail straight section

VI.Maintenance and Care

Note: Before maintenance and servicing,please make sure to turn off the switch and disconnect the power supply of the equipment.

1.This machine should be maintained regularly as follows:

a) After each shift,clean the iron filings remaining on the equipment to keep it clean.

b) Observe the tightness of the belt and adjust it if necessary.

c) Regularly check whether the fastening screws of each partare loose.

d) For the bearings of the knife shaft,add 46# lubricating oil once every six months.

e) If the blade is worn or damaged,replace the blade with another intact cutting edge.If all four cutting edgesof the blade are worn,it is necessary to replace it. Otherwise,it willaffect the surface quality of the processed work and the lifespan of the equipment.

f)After the machine has been working for some time, the belt may stretch, resulting in a decrease in transmission efficiency and a reduction in the cutting speed of the cutting components,which directly affects the processing quality and efficiency.Therefore,belt adjustment is very necessary.

Note:This maintenance information is applicable to: AX1500ST/T/S/D/C and other fullseries.

2.Replace the guide wheel (refer to Figure N)

Figure Q: The size of the ch amfer shown in the illustration

Note:There is no specific basis for the damage time of the guide wheel. Generally, it depends on the user's usage habits and working duration.The smoothness of the guide wheel can improve the surface quality of the processed parts,increase work efficiency,and extend the service life of the tool shaft.

a) Rotate counterclockwise to remove the fixing screws nl and the gasket n2 one by one.

b) Remove the guide wheel n3 and replace it with a new guide wheel bearing.

c)Finally,fix the fixing screws nl and the gasket n2 onto the guide wheel.

Note:This operation procedure is applicable to:AXl500ST,AX1500S, AX1100C.

3.Regularly clean the ventilation openings (see Figure O)

Please note that regular cleaning of ventilation outlets and preventing them from getting clogged can effectively enhance the lifespan of the equipment.

4.Regularly clean the dust collection drawer (see Fig.P)

Note: The linear part of the slide rail has no dust collection drawer.You can ignore this information.

First,remove the arc guiding plate,then remove the dust collection drawer. Regularly clean the iron filings inside the drawer to extend the equipment's lifespan.

Note:This operation step is applicable to AX1500S and AX1500D;

Vll.EnvironmentalProtection

Handlewastematerials

In response to environmental protection,for damaged machines,spare partsand packagingmaterials,detailed classification and processing must be carried out to facilitate recycling.To facilitate the classification and recycling,material identification ismade for each plastic part.

Warranty Policy

Dear User,

Thank you very much for purchasing the AOCKE professional bench angle grinder.To ensure you receive high-qualityafter-sales service,please pay attention to the following matters:

1.The AOCKE professional bench angle grinder undergoes strict inspection before leaving the factory. 2.The warranty commitment for the AOCKE professional bench angle grinder is only applicable to consumers who purchase genuine AOCKE professional bench angle grinders.
3.Undernormal usage conditions,the AOCKE AX1500 series bench angle grinder is guaranteed fora warranty period of 6 months from the purchase date.
4.Toensureyoucanenjoythewarrantyservice,please promptlyfilloutthewarrantycardand returnthereplyslip within2weeks to theAOCKEauthorized after-salesservicecenter.We highlyvalueand appreciate yourvaluable opinions.
5.Forwarranty maters,please contact your nearestdesignated dealerorafter-salesservicecenter directly. 6.During warranty service,please bring the following materials and items:
6.1 Provide the complete product and ensure the labels are intact,with serial numbers and batch numbers identifiable;
6.2 Attach the purchase voucher (invoice receipt,etc.);
6.3Warranty card and warranty record sheet.
7.Typical faults and wear parts are not covered by warranty:
7.1If the motor is burned out due to circuit problems,it cannot be regarded as a warranty object.
7.2If theuser has exceededthe design function of themachineorhas used the toolfora long time and at high intensity,orifthe motoroverheatsorthestatorisburnedout,itcannotberegardedasawarrntyobject. 8.The following situations are not covered by warranty:
8.1 The machine is misused or abused;
8.2The machine is severely overloaded;
8.3The product is damaged by external objects,foreign substances (sand grains or iron filings),or accidental accidents;
8.4Any product that has been opened,repaired,replaced parts,or modified by the user;
8.5Any damage caused by improper transportation or storage after the product is sold;
8.6 Damage caused by the user's improper use of AOCKE original partsand accessories;
8.7 Replacement of wear parts such as blades,guide wheels,and consumable accessories.
9.Theequipmentismainlycomposed of mechanicalpartsand sheetmetalparts,soonlythe motorcoilis guaranteed for 6 months,and other mechanical parts are not covered by warranty.
10.Duetothecontinuousimprovementand upgradingoftheproduct,ifthere are inconsistenciesinappearance and parameters,the actual product shall prevail.

AOKE After-sales Service Center

Address:No.42，Shenghuan Road，Yankupu
Village， FenggangTown，DongguanCity，
Guangdong Province
Telephone:0769-82083030
Postal Code:523707

Common Questions and Troubleshooting Methods

When the maintenance involves replacing parts,we suggest that you select the original accessories from the store where you purchased this chamfering machine.Please choose the correct accessories that are suitable foryour work.

AOCKE奥坚

Product warranty card

Unified service telephone 0769-82083030

Dongguan Hangyuan hardware tools Co.,LTD No.42,Deep Ring Road,Youganpu Village,FenggangTown,Dongguan City Zip Code:523707 www.aocke.cn

AOCKE奥坚

Product warranty card

Unified service telephone 0769-82083030

Dongguan Hangyuan hardware tools Co.,LTD No.42,Deep Ring Road,Youganpu Village,Fenggang Town,Dongguan City Zip Code:523707 www.aocke.cn

Please be careful Please wear protective glasses Please wear protective earmuffs
Read the instructions
Please wear a dust mask 4 Waming mark 回

AOCKE奥坚 Product warranty card

Important: Inorderto guarantee the free warranty of your Ojian power tools,please complete the form belowand return itwithin one month.

Username: Lady/Gentleman Unitname: Yourindustry: Mold mold frame Mold processing machining sheet metal valve shipbuildingindustry stee structure Boilerpiping High-speedrailtrackotherindustries Whichperfomancedoesyourcomparypaymostattentionto: Chamferfinish Morecutting □Easiertouse □

Address: province _city District/County street Zip CODE: Email: Landline: Mobile Phone:

Machine model: Usage: Date of Purchase: Invoice Number:

Dealer Name:
Dealer Address:
Distributor phone: Dealer seal:

AOCKE奥坚 Product warranty card

Duringthewarrantyperiod,theusermustpresentthiscardandpurchaseticketinordertoperformthe warrantyservice.

User name: Lady/Gentleman Unitname: Yourindustry: Mold mold frame Mold processing machining sheet metal valve shipbuildingindustrysteel structure Boiler piping High-speed rail track Otherindustries Whichperfommancedoesyourcompanypaymostattentionto:Chamferfinish Morecutting Easierto use □

Address: province city District/County street Zip CODE: Email: Landline: MobilePhone:

Machine model: Usage: Date of Purchase: Invoice Number:

Dealer Name:
Dealer Address:
Distributor phone:_ Dealerseal: